SPATA12 Antibody
| Name | SPATA12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86204 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVSQINLLGRPSSPPALLIQQGSCEQVIHNSTPQFLGMEDGDNERTTGWLWRLCEDIDAEPSSTGCSRSNQLTFTEGCFVRSLSTVYSNTH |
| Description | Rabbit Polyclonal |
| Gene | SPATA12 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SPATA12 Antibody [NBP1-86204] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/21159_SPATA12%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86204-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SPATA12 Antibody [NBP1-86204] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.
![Immunohistochemistry-Paraffin: SPATA12 Antibody [NBP1-86204] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/21160_SPATA12%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86204-img0002.jpg)
Immunohistochemistry-Paraffin: SPATA12 Antibody [NBP1-86204] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.