NRAP Antibody

Name NRAP Antibody
Supplier Novus Biologicals
Catalog NBP1-86267
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:RHDFVKERGKLIGPQSVRDDPRIQHCRRMGQLQSELQYRRGATSSQAQFHLPMDMVHLVHAKNAQALASDHDYRTQYHKFTALPE
Purity/Format Immunogen affinity purified
Blocking Peptide NRAP Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene NRAP
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.