H1FOO Antibody
| Name | H1FOO Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86265 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | H1FOO Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | H1FOO |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: H1FOO Antibody [NBP1-86265] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14204_H1FOO%2520Antibody-Western%2520Blot-NBP1-86265-img0004.jpg)
Western Blot: H1FOO Antibody [NBP1-86265] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: H1FOO Antibody [NBP1-86265] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14205_H1FOO-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86265-img0003.jpg)
Immunocytochemistry/Immunofluorescence: H1FOO Antibody [NBP1-86265] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
![Immunohistochemistry-Paraffin: H1FOO Antibody [NBP1-86265] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14206_H1FOO-Antibody-Immunohistochemistry-Paraffin-NBP1-86265-img0002.jpg)
Immunohistochemistry-Paraffin: H1FOO Antibody [NBP1-86265] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.