CIB4 Antibody
| Name | CIB4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86293 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CIB4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CIB4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: CIB4 Antibody [NBP1-86293] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (actin filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5432_CIB4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86293-img0003.jpg)
![Immunohistochemistry-Paraffin: CIB4 Antibody [NBP1-86293] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5433_CIB4%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86293-img0002.jpg)