TRIM65 Antibody
| Name | TRIM65 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86423 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:WHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQPGAVFPLG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRIM65 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRIM65 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: TRIM65 Antibody [NBP1-86423] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7629_TRIM65%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86423-img0006.jpg)
![Immunohistochemistry-Paraffin: TRIM65 Antibody [NBP1-86423] - Staining of human spleen shows cytoplasmic positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7630_TRIM65-Antibody-Immunohistochemistry-Paraffin-NBP1-86423-img0005.jpg)