C17orf58 Antibody
| Name | C17orf58 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86418 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQVLRGRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C17orf58 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C17orf58 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C17orf58 Antibody [NBP1-86418] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8301_C17orf58%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86418-img0006.jpg)
Immunocytochemistry/Immunofluorescence: C17orf58 Antibody [NBP1-86418] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: C17orf58 Antibody [NBP1-86418] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8302_C17orf58-Antibody-Immunohistochemistry-Paraffin-NBP1-86418-img0005.jpg)
Immunohistochemistry-Paraffin: C17orf58 Antibody [NBP1-86418] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.