IMPA2 Antibody
| Name | IMPA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86352 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IMPA2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IMPA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: IMPA2 Antibody [NBP1-86352] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415429)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13307_IMPA2-Antibody-Western-Blot-NBP1-86352-img0004.jpg)
Western Blot: IMPA2 Antibody [NBP1-86352] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415429)
![Immunocytochemistry/Immunofluorescence: IMPA2 Antibody [NBP1-86352] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13308_IMPA2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86352-img0006.jpg)
Immunocytochemistry/Immunofluorescence: IMPA2 Antibody [NBP1-86352] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & mitochondria.
![Immunohistochemistry-Paraffin: IMPA2 Antibody [NBP1-86352] - Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13309_IMPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-86352-img0002.jpg)
Immunohistochemistry-Paraffin: IMPA2 Antibody [NBP1-86352] - Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.