FSD1L Antibody
| Name | FSD1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86583 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FSD1L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FSD1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FSD1L Antibody [NBP1-86583] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoskeleton (actin filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5075_FSD1L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86583-img0003.jpg)
Immunocytochemistry/Immunofluorescence: FSD1L Antibody [NBP1-86583] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoskeleton (actin filaments).
![Immunohistochemistry-Paraffin: FSD1L Antibody [NBP1-86583] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5076_FSD1L-Antibody-Immunohistochemistry-Paraffin-NBP1-86583-img0004.jpg)
Immunohistochemistry-Paraffin: FSD1L Antibody [NBP1-86583] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.