MS4A6A Antibody
| Name | MS4A6A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86541 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MS4A6A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MS4A6A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MS4A6A Antibody [NBP1-86541] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5113_MS4A6A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86541-img0003.jpg)
Immunocytochemistry/Immunofluorescence: MS4A6A Antibody [NBP1-86541] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles.
![Immunohistochemistry-Paraffin: MS4A6A Antibody [NBP1-86541] - Staining of human pancreas shows strong nuclear positivity in exocrine cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5114_MS4A6A%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86541-img0002.jpg)
Immunohistochemistry-Paraffin: MS4A6A Antibody [NBP1-86541] - Staining of human pancreas shows strong nuclear positivity in exocrine cells.