MS4A7 Antibody
| Name | MS4A7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86540 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MS4A7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MS4A4A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MS4A7 Antibody [NBP1-86540] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9257_MS4A7-Antibody-Western-Blot-NBP1-86540-img0005.jpg)
Western Blot: MS4A7 Antibody [NBP1-86540] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
![Immunohistochemistry-Paraffin: MS4A7 Antibody [NBP1-86540] - Staining of human appendix shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9258_MS4A7-Antibody-Immunohistochemistry-Paraffin-NBP1-86540-img0002.jpg)
Immunohistochemistry-Paraffin: MS4A7 Antibody [NBP1-86540] - Staining of human appendix shows strong cytoplasmic positivity in glandular cells.