MURC Antibody
| Name | MURC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86607 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MURC Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MURC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MURC Antibody [NBP1-86607] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoskeleton (microtubules).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26709_MURC%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86607-img0003.jpg)
Immunocytochemistry/Immunofluorescence: MURC Antibody [NBP1-86607] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoskeleton (microtubules).
![Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86607] - Staining of human skeletal muscle shows moderate membranous positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26710_MURC%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86607-img0002.jpg)
Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86607] - Staining of human skeletal muscle shows moderate membranous positivity in myocytes.