HDHD3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-86706
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVV
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: HDHD3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: HDHD3
• Conjugate: Unconjugated

Product images

Western Blot: HDHD3 Antibody [NBP1-86706] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: HDHD3 Antibody [NBP1-86706] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli.

Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86706] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.