CMYA5 Antibody
| Name | CMYA5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86776 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SASQVLTTEKEKSYTGIYDKARKKKTTSNTPPITGAIYKEHKPLVLRPVYIGTVQYKIKMFNSVKEELIPLQFYGTLPKGYVI |
| Description | Rabbit Polyclonal |
| Gene | CMYA5 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CMYA5 Antibody [NBP1-86776] - Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/21525_CMYA5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86776-img0003.jpg)
Immunocytochemistry/Immunofluorescence: CMYA5 Antibody [NBP1-86776] - Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & centrosome.
![Immunohistochemistry-Paraffin: CMYA5 Antibody [NBP1-86776] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/21526_CMYA5%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86776-img0002.jpg)
Immunohistochemistry-Paraffin: CMYA5 Antibody [NBP1-86776] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.