RRP36 Antibody

Name RRP36 Antibody
Supplier Novus Biologicals
Catalog NBP1-86758
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:NACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQ
Purity/Format Immunogen affinity purified
Blocking Peptide RRP36 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene RRP36
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.