Treacher Collins syndrome protein Antibody
| Name | Treacher Collins syndrome protein Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86908 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTAS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Treacher Collins syndrome protein Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TCOF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Treacher Collins syndrome protein Antibody [NBP1-86908] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15446_Treacher%2520Collins%2520syndrome%2520protein%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86908-img0007.jpg)
Immunocytochemistry/Immunofluorescence: Treacher Collins syndrome protein Antibody [NBP1-86908] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
![Immunohistochemistry-Paraffin: Treacher Collins syndrome protein Antibody [NBP1-86908] - Staining of human rectum shows moderate nucleolar and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15447_Treacher-Collins-syndrome-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-86908-img0006.jpg)
Immunohistochemistry-Paraffin: Treacher Collins syndrome protein Antibody [NBP1-86908] - Staining of human rectum shows moderate nucleolar and cytoplasmic positivity in glandular cells.