SFRS8 Antibody
| Name | SFRS8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87052 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SFRS8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SFSWAP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SFRS8 Antibody [NBP1-87052] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7047_SFRS8%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87052-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SFRS8 Antibody [NBP1-87052] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: SFRS8 Antibody [NBP1-87052] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7048_SFRS8-Antibody-Immunohistochemistry-Paraffin-NBP1-87052-img0002.jpg)
Immunohistochemistry-Paraffin: SFRS8 Antibody [NBP1-87052] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.