ZZEF1 Antibody
| Name | ZZEF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83828 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DYFFLEVQKRFDGDELTTDERIRSLAQRWQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZZEF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZZEF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZZEF1 Antibody [NBP1-83828] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25564_ZZEF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83828-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ZZEF1 Antibody [NBP1-83828] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
![Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25565_ZZEF1-Antibody-Immunohistochemistry-Paraffin-NBP1-83828-img0002.jpg)
Immunohistochemistry-Paraffin: ZZEF1 Antibody [NBP1-83828] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.