FKBP14 Antibody
| Name | FKBP14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83891 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FKBP14 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FKBP14 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FKBP14 Antibody [NBP1-83891] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/21842_FKBP14-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83891-img0004.jpg)
Immunocytochemistry/Immunofluorescence: FKBP14 Antibody [NBP1-83891] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: FKBP14 Antibody [NBP1-83891] - Staining of human cerebral cortex shows distinct nucleolar and cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/21843_FKBP14-Antibody-Immunohistochemistry-Paraffin-NBP1-83891-img0005.jpg)
Immunohistochemistry-Paraffin: FKBP14 Antibody [NBP1-83891] - Staining of human cerebral cortex shows distinct nucleolar and cytoplasmic positivity in neuronal cells.