FAM63A Antibody
| Name | FAM63A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83759 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PLPEASSAPPGPTLGTLPEVETIRACSMPQELPQSPRTRQPEPDFYCVKWIPWKGEQTPIITQSTNGPCPLLAIMNI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM63A Protein |
| Description | Rabbit Polyclonal |
| Gene | FAM63A |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: FAM63A Antibody [NBP1-83759] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3144_FAM63A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83759-img0004.jpg)
![Immunohistochemistry-Paraffin: FAM63A Antibody [NBP1-83759] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3145_FAM63A-Antibody-Immunohistochemistry-Paraffin-NBP1-83759-img0005.jpg)