SH3YL1 Antibody
| Name | SH3YL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84134 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SH3YL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SH3YL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SH3YL1 Antibody [NBP1-84134] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5985_SH3YL1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84134-img0006.jpg)
Immunocytochemistry/Immunofluorescence: SH3YL1 Antibody [NBP1-84134] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
![Immunohistochemistry-Paraffin: SH3YL1 Antibody [NBP1-84134] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in cells of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5986_SH3YL1-Antibody-Immunohistochemistry-Paraffin-NBP1-84134-img0005.jpg)
Immunohistochemistry-Paraffin: SH3YL1 Antibody [NBP1-84134] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in cells of tubules.