DEFB119 Antibody
| Name | DEFB119 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84280 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DEFB119 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DEFB119 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DEFB119 Antibody [NBP1-84280] - Staining of human cell line A-431 shows positivity in nucleoli, cytoplasm and cytoskeleton (intermediate filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26503_DEFB119-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84280-img0004.jpg)
Immunocytochemistry/Immunofluorescence: DEFB119 Antibody [NBP1-84280] - Staining of human cell line A-431 shows positivity in nucleoli, cytoplasm and cytoskeleton (intermediate filaments).
![Immunohistochemistry-Paraffin: DEFB119 Antibody [NBP1-84280] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts..](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26504_DEFB119-Antibody-Immunohistochemistry-Paraffin-NBP1-84280-img0005.jpg)
Immunohistochemistry-Paraffin: DEFB119 Antibody [NBP1-84280] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts..