TMEM45A Antibody
| Name | TMEM45A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84268 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FITWLVKSRLKRLCSSEVGLLKNAEREQESEEE |
| Description | Rabbit Polyclonal |
| Gene | TMEM45A |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TMEM45A Antibody [NBP1-84268] - Staining of human cell line U-251MG shows positivity in cytoskeleton (intermediate filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/22016_TMEM45A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84268-img0003.jpg)
Immunocytochemistry/Immunofluorescence: TMEM45A Antibody [NBP1-84268] - Staining of human cell line U-251MG shows positivity in cytoskeleton (intermediate filaments).
![Immunohistochemistry-Paraffin: TMEM45A Antibody [NBP1-84268] - Staining of human tonsil shows distinct cytoplasmic positivity in reaction center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/22017_TMEM45A%2520Antibody-Immunohistochemistry-Paraffin-NBP1-84268-img0002.jpg)
Immunohistochemistry-Paraffin: TMEM45A Antibody [NBP1-84268] - Staining of human tonsil shows distinct cytoplasmic positivity in reaction center cells.