TPD52L1/D53 Antibody
| Name | TPD52L1/D53 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84313 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TPD52L1/D53 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TPD52L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TPD52L1/D53 Antibody [NBP1-84313] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16531_TPD52L1-D53-Antibody-Western-Blot-NBP1-84313-img0005.jpg)
Western Blot: TPD52L1/D53 Antibody [NBP1-84313] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7
![Immunocytochemistry/Immunofluorescence: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16532_TPD52L1-D53-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84313-img0006.jpg)
Immunocytochemistry/Immunofluorescence: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & cell junctions.
![Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human salivary gland shows distinct cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16533_TPD52L1-D53-Antibody-Immunohistochemistry-Paraffin-NBP1-84313-img0002.jpg)
Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human salivary gland shows distinct cytoplasmic positivity in glandular cells.