DCDC2 Antibody
| Name | DCDC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84298 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DCDC2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DCDC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DCDC2 Antibody [NBP1-84298] - Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26037_DCDC2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84298-img0007.jpg)
Immunocytochemistry/Immunofluorescence: DCDC2 Antibody [NBP1-84298] - Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.
![Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP1-84298] - Staining of human fallopian tube shows strong positivity in cilia of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26038_DCDC2-Antibody-Immunohistochemistry-Paraffin-NBP1-84298-img0006.jpg)
Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP1-84298] - Staining of human fallopian tube shows strong positivity in cilia of glandular cells.