DSCR3 Antibody
| Name | DSCR3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84296 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DSCR3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DSCR3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DSCR3 Antibody [NBP1-84296] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5158_DSCR3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84296-img0004.jpg)
Immunocytochemistry/Immunofluorescence: DSCR3 Antibody [NBP1-84296] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
![Immunohistochemistry-Paraffin: DSCR3 Antibody [NBP1-84296] - Staining of human rectum shows strong cytoplasmic positivity in granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5159_DSCR3-Antibody-Immunohistochemistry-Paraffin-NBP1-84296-img0002.jpg)
Immunohistochemistry-Paraffin: DSCR3 Antibody [NBP1-84296] - Staining of human rectum shows strong cytoplasmic positivity in granular pattern in glandular cells.