C9orf16 Antibody
| Name | C9orf16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83955 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C9orf16 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C9orf16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C9orf16 Antibody [NBP1-83955] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25503_C9orf16%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83955-img0005.jpg)
Immunocytochemistry/Immunofluorescence: C9orf16 Antibody [NBP1-83955] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
![Immunohistochemistry-Paraffin: C9orf16 Antibody [NBP1-83955] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25504_C9orf16-Antibody-Immunohistochemistry-Paraffin-NBP1-83955-img0001.jpg)
Immunohistochemistry-Paraffin: C9orf16 Antibody [NBP1-83955] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.