ETFDH Antibody
| Name | ETFDH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83950 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LAVAHEKDIRVCLVEKAAQIGAHTLSGACLDPGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ETFDH Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ETFDH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ETFDH Antibody [NBP1-83950] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4442_ETFDH%2520Antibody-Western%2520Blot-NBP1-83950-img0004.jpg)
Western Blot: ETFDH Antibody [NBP1-83950] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
![Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4443_ETFDH-Antibody-Immunohistochemistry-Paraffin-NBP1-83950-img0001.jpg)
Immunohistochemistry-Paraffin: ETFDH Antibody [NBP1-83950] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.