HAPLN3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-83945
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:GLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSEN
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: HAPLN3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: HAPLN3
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: HAPLN3 Antibody [NBP1-83945] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: HAPLN3 Antibody [NBP1-83945] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells, myoepithelial cells and extra cellular matrix.

Immunohistochemistry-Paraffin: HAPLN3 Antibody [NBP1-83945] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.