ZNF198 Antibody
| Name | ZNF198 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84685 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF198 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZMYM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZNF198 Antibody [NBP1-84685] - Staining of human cell line A-431 shows localization to nucleoplasm & endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15300_ZNF198-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84685-img0006.jpg)
Immunocytochemistry/Immunofluorescence: ZNF198 Antibody [NBP1-84685] - Staining of human cell line A-431 shows localization to nucleoplasm & endoplasmic reticulum.
![Immunohistochemistry-Paraffin: ZNF198 Antibody [NBP1-84685] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15301_ZNF198-Antibody-Immunohistochemistry-Paraffin-NBP1-84685-img0002.jpg)
Immunohistochemistry-Paraffin: ZNF198 Antibody [NBP1-84685] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
![Immunocytochemistry/Immunofluorescence: ZNF198 Antibody [NBP1-84685] - Staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15302_ZNF198-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84685-img0005.jpg)
Immunocytochemistry/Immunofluorescence: ZNF198 Antibody [NBP1-84685] - Staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.