ARHGAP28 Antibody
| Name | ARHGAP28 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84641 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KSIPRCRRINRMLSNESLHPPAFSRSNSEASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ARHGAP28 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ARHGAP28 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ARHGAP28 Antibody [NBP1-84641] Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6793_ARHGAP28%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84641-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ARHGAP28 Antibody [NBP1-84641] Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84641] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in a subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6794_ARHGAP28%2520Antibody-Immunohistochemistry-Paraffin-NBP1-84641-img0002.jpg)
Immunohistochemistry-Paraffin: ARHGAP28 Antibody [NBP1-84641] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in a subset of cells in seminiferus ducts.