NFKBID Antibody
| Name | NFKBID Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81604 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHT |
| Description | Rabbit Polyclonal |
| Gene | NFKBID |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: NFKBID Antibody [NBP1-81604] - Staining of human cell line A-431 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/22358_NFKBID%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81604-img0004.jpg)
![Immunohistochemistry-Paraffin: NFKBID Antibody [NBP1-81604] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/22359_NFKBID%2520Antibody-Immunohistochemistry-Paraffin-NBP1-81604-img0002.jpg)