TMEM116 Antibody
| Name | TMEM116 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81881 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GNTSECFQNFSQSHKCILMHSPPSAMAELPPSANTSVCS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TMEM116 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TMEM116 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TMEM116 Antibody [NBP1-81881] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13346_TMEM116-Antibody-Western-Blot-NBP1-81881-img0004.jpg)
Western Blot: TMEM116 Antibody [NBP1-81881] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: TMEM116 Antibody [NBP1-81881] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & microtubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13347_TMEM116%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81881-img0005.jpg)
Immunocytochemistry/Immunofluorescence: TMEM116 Antibody [NBP1-81881] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & microtubules.
![Immunohistochemistry-Paraffin: TMEM116 Antibody [NBP1-81881] - Staining of human nasopharynx shows strong cytoplasmic and membranous positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13348_TMEM116-Antibody-Immunohistochemistry-Paraffin-NBP1-81881-img0002.jpg)
Immunohistochemistry-Paraffin: TMEM116 Antibody [NBP1-81881] - Staining of human nasopharynx shows strong cytoplasmic and membranous positivity in respiratory epithelial cells.