Polypeptide GalNac Transferase 1/GALNT1 Antibody
| Name | Polypeptide GalNac Transferase 1/GALNT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81852 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GALNT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852] - Analysis in human cell line RT-4.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5323_Polypeptide%2520GalNac%2520Transferase%25201-GALNT1%2520Antibody-Western%2520Blot-NBP1-81852-img0005.jpg)
Western Blot: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852] - Analysis in human cell line RT-4.
![Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852] - Staining of human stomach shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5324_Polypeptide-GalNac-Transferase-1-GALNT1-Antibody-Immunohistochemistry-Paraffin-NBP1-81852-img0002.jpg)
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852] - Staining of human stomach shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.