GALNTL6 Antibody
| Name | GALNTL6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81845 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GALNTL6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GALNTL6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GALNTL6 Antibody [NBP1-81845] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-228](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4582_GALNTL6-Antibody-Western-Blot-NBP1-81845-img0005.jpg)
![Immunohistochemistry-Paraffin: GALNTL6 Antibody [NBP1-81845] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4583_GALNTL6-Antibody-Immunohistochemistry-Paraffin-NBP1-81845-img0002.jpg)