GIGYF1 Antibody
| Name | GIGYF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81785 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DTLEAKEFAKQFLERRAKQKASQQRQQQQEAWLSSASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPSILGYSL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GIGYF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GIGYF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GIGYF1 Antibody [NBP1-81785] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4468_GIGYF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81785-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GIGYF1 Antibody [NBP1-81785] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
![Immunocytochemistry/Immunofluorescence: GIGYF1 Antibody [NBP1-81785] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4469_GIGYF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81785-img0005.jpg)
Immunocytochemistry/Immunofluorescence: GIGYF1 Antibody [NBP1-81785] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.