ISM2 Antibody
| Name | ISM2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82001 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LREEEEARLLPRTHLQAELHQHGCWTVTEPAALTPGNATPPRTQEVTPLLLELQKLPELVHATLSTPNPDNQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ISM2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ISM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ISM2 Antibody [NBP1-82001] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24831_ISM2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82001-img0007.jpg)
Immunocytochemistry/Immunofluorescence: ISM2 Antibody [NBP1-82001] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: ISM2 Antibody [NBP1-82001] - Staining of human placenta shows strong cytoplasmic positivity in a subset of trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24832_ISM2-Antibody-Immunohistochemistry-Paraffin-NBP1-82001-img0006.jpg)
Immunohistochemistry-Paraffin: ISM2 Antibody [NBP1-82001] - Staining of human placenta shows strong cytoplasmic positivity in a subset of trophoblastic cells.
![Immunocytochemistry/Immunofluorescence: ISM2 Antibody [NBP1-82001] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24833_ISM2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82001-img0005.jpg)
Immunocytochemistry/Immunofluorescence: ISM2 Antibody [NBP1-82001] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.