CXorf56 Antibody

Name CXorf56 Antibody
Supplier Novus Biologicals
Catalog NBP1-82097
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:RRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKD
Purity/Format Immunogen affinity purified
Blocking Peptide CXorf56 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CXorf56
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.