HFM1 Antibody
| Name | HFM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81954 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCK |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HFM1 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: HFM1 Antibody [NBP1-81954] - Staining of human cell line U-2 OS shows positivity in vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/22576_HFM1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81954-img0005.jpg)
![Immunohistochemistry-Paraffin: HFM1 Antibody [NBP1-81954] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/22577_HFM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81954-img0006.jpg)