SLC36A4 Antibody
| Name | SLC36A4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81931 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC36A4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC36A4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC36A4 Antibody [NBP1-81931] - Staining of human cell line U-2 OS shows positivity in plasma membrane, golgi apparatus and vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24880_SLC36A4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81931-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SLC36A4 Antibody [NBP1-81931] - Staining of human cell line U-2 OS shows positivity in plasma membrane, golgi apparatus and vesicles.
![Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24881_SLC36A4-Antibody-Immunohistochemistry-Paraffin-NBP1-81931-img0002.jpg)
Immunohistochemistry-Paraffin: SLC36A4 Antibody [NBP1-81931] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
![Immunocytochemistry/Immunofluorescence: SLC36A4 Antibody [NBP1-81931] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24882_SLC36A4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81931-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC36A4 Antibody [NBP1-81931] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.