TRIM50 Antibody
| Name | TRIM50 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81988 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRIM50 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRIM50 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3253_TRIM50-Antibody-Immunohistochemistry-Paraffin-NBP1-81988-img0005.jpg)
Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.