TRMT1 Antibody
| Name | TRMT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82197 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:EHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRM1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRMT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TRMT1 Antibody [NBP1-82197] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6016_TRMT1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82197-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TRMT1 Antibody [NBP1-82197] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
![Immunohistochemistry-Paraffin: TRMT1 Antibody [NBP1-82197] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6017_TRMT1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-82197-img0002.jpg)
Immunohistochemistry-Paraffin: TRMT1 Antibody [NBP1-82197] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.