CPNE5 Antibody
| Name | CPNE5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84406 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CPNE5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CPNE5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CPNE5 Antibody [NBP1-84406] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6246_CPNE5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84406-img0007.jpg)
Immunocytochemistry/Immunofluorescence: CPNE5 Antibody [NBP1-84406] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
![Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6247_CPNE5-Antibody-Immunohistochemistry-Paraffin-NBP1-84406-img0006.jpg)
Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
![Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6248_CPNE5-Antibody-Immunohistochemistry-Paraffin-NBP1-84406-img0005.jpg)
Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.