CMTM4 Antibody

Name CMTM4 Antibody
Supplier Novus Biologicals
Catalog NBP1-84457
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ
Purity/Format Immunogen affinity purified
Blocking Peptide CMTM4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CMTM4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.