THAP2 Antibody
| Name | THAP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84157 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | THAP2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | THAP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: THAP2 Antibody [NBP1-84157] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25367_THAP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84157-img0004.jpg)
Immunocytochemistry/Immunofluorescence: THAP2 Antibody [NBP1-84157] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and golgi apparatus.
![Immunohistochemistry-Paraffin: THAP2 Antibody [NBP1-84157] - Staining of human stomach, upper shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25368_THAP2-Antibody-Immunohistochemistry-Paraffin-NBP1-84157-img0005.jpg)
Immunohistochemistry-Paraffin: THAP2 Antibody [NBP1-84157] - Staining of human stomach, upper shows strong granular cytoplasmic positivity in glandular cells.