MED31 Antibody

Name MED31 Antibody
Supplier Novus Biologicals
Catalog NBP1-84519
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC
Purity/Format Immunogen affinity purified
Blocking Peptide MED31 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene MED31
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.