NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody
| Name | NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84511 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NFU1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody [NBP1-84511] Staining of human cell line U-251 MG shows positivity in nucleus, cytoplasm & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/22993_NFU1%2520iron-sulfur%2520cluster%2520scaffold%2520homolog%2520%2528S.%2520cerevisiae%2529%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84511-img0004.jpg)
Immunocytochemistry/Immunofluorescence: NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody [NBP1-84511] Staining of human cell line U-251 MG shows positivity in nucleus, cytoplasm & centrosome.
![Immunohistochemistry-Paraffin: NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody [NBP1-84511] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/22994_NFU1%2520iron-sulfur%2520cluster%2520scaffold%2520homolog%2520%2528S.%2520cerevisiae%2529%2520Antibody-Immunohistochemistry-Paraffin-NBP1-84511-img0002.jpg)
Immunohistochemistry-Paraffin: NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody [NBP1-84511] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.