CDRT4 Antibody
| Name | CDRT4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84559 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CDRT4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TVP23C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM18B2 Antibody [NBP1-84559] - Staining of human cell line U-2 OS shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8702_FAM18B2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84559-img0005.jpg)
Immunocytochemistry/Immunofluorescence: FAM18B2 Antibody [NBP1-84559] - Staining of human cell line U-2 OS shows positivity in mitochondria.
![Immunohistochemistry-Paraffin: FAM18B2 Antibody [NBP1-84559] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes and bile duct cells are negative.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8703_FAM18B2-Antibody-Immunohistochemistry-Paraffin-NBP1-84559-img0006.jpg)
Immunohistochemistry-Paraffin: FAM18B2 Antibody [NBP1-84559] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes and bile duct cells are negative.