AKIRIN1 Antibody
| Name | AKIRIN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14749 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAP SSPGSSWMKKDQPTFT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AKIRIN1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AKIRIN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: AKIRIN1 Antibody [NBP2-14749] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11749_AKIRIN1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14749-img0005.jpg)
Immunocytochemistry/Immunofluorescence: AKIRIN1 Antibody [NBP2-14749] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: AKIRIN1 Antibody [NBP2-14749] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11750_AKIRIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-14749-img0004.jpg)
Immunohistochemistry-Paraffin: AKIRIN1 Antibody [NBP2-14749] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.