Mitochondrial Ribosomal Protein S18C Antibody
| Name | Mitochondrial Ribosomal Protein S18C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14807 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFM PVTYKDPAYLKDPKVCNIRYR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Mitochondrial Ribosomal Protein S18C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MRPS18C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Mitochondrial Ribosomal Protein S18C Antibody [NBP2-14807] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11353_Mitochondrial-Ribosomal-Protein-S18C-Antibody-Western-Blot-NBP2-14807-img0004.jpg)
Western Blot: Mitochondrial Ribosomal Protein S18C Antibody [NBP2-14807] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunohistochemistry-Paraffin: Mitochondrial Ribosomal Protein S18C Antibody [NBP2-14807] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11354_Mitochondrial-Ribosomal-Protein-S18C-Antibody-Immunohistochemistry-Paraffin-NBP2-14807-img0001.jpg)
Immunohistochemistry-Paraffin: Mitochondrial Ribosomal Protein S18C Antibody [NBP2-14807] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.