RNF181 Antibody
| Name | RNF181 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13240 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLP PPAAKTVVENLPRTVIRGSQAELKCP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF181 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RNF181 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RNF181 Antibody [NBP2-13240] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13670_RNF181-Antibody-Western-Blot-NBP2-13240-img0003.jpg)
Western Blot: RNF181 Antibody [NBP2-13240] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: RNF181 Antibody [NBP2-13240] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13671_RNF181-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13240-img0005.jpg)
Immunocytochemistry/Immunofluorescence: RNF181 Antibody [NBP2-13240] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: RNF181 Antibody [NBP2-13240] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13672_RNF181-Antibody-Immunohistochemistry-Paraffin-NBP2-13240-img0001.jpg)
Immunohistochemistry-Paraffin: RNF181 Antibody [NBP2-13240] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.